Product Overview
Product Overview
Abbreviation
Recombinant Mouse Ig kappa chain V-V region K2 protein
Alternative names
Ig kappa chain V-V region K2; Fragment
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
21-115aa
Form
Liquid or Lyophilized powder
Mw
17.4 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Mus musculus (Mouse)
Protein length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Multiple related immunoglobulin variable-region genes identified by cloning and sequence analysis."
Seidman J.G., Leder A., Edgell M.H., Polsky F., Tilghman S.M., Tiemeier D.C., Leder P.
Proc. Natl. Acad. Sci. U.S.A. 75:3881-3885(1978)
Relevance
The gene was isolated and sequenced separately from two different sources, embryos and cultured plasmacytoma cells that secrete the similar kappa chain MOPC 149.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP
Uniprot id
P01635
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Mouse Ig kappa chain V-V region K2
Recombinant Mouse Ig kappa chain V-V region K2
Regular price
$2,466.00 USD
Sale price
$2,466.00 USD
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Mouse Ig kappa chain V-V region K2 protein
Alternative names
Ig kappa chain V-V region K2; Fragment
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
21-115aa
Form
Liquid or Lyophilized powder
Mw
17.4 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Mus musculus (Mouse)
Protein length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Multiple related immunoglobulin variable-region genes identified by cloning and sequence analysis."
Seidman J.G., Leder A., Edgell M.H., Polsky F., Tilghman S.M., Tiemeier D.C., Leder P.
Proc. Natl. Acad. Sci. U.S.A. 75:3881-3885(1978)
Relevance
The gene was isolated and sequenced separately from two different sources, embryos and cultured plasmacytoma cells that secrete the similar kappa chain MOPC 149.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP
Uniprot id
P01635
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Mouse Ig kappa chain V-V region K2
Regular price
$2,466.00 USD
Sale price
$2,466.00 USD
Regular price
Unit price
/per

