Product Overview
Product Overview
Abbreviation
Recombinant Crimean-Congo hemorrhagic fever virus GP protein, partial (Active)
Alternative names
Envelopment polyprotein; M polyprotein; Mucin-like variable region; GP38; Glycoprotein NNon-Structural protein M; Glycoprotein C; GP
Buffer [rich text]
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Expression region
1078-1439aa
Form
Lyophilized powder
Gene names
GP
Mw
42.2 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) (CCHFV)
Protein length
Partial
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Intracellular localization of Crimean-Congo Hemorrhagic Fever (CCHF) virus glycoproteins.
Haferkamp S., Fernando L., Schwarz T.F., Feldmann H., Flick R.
Virol. J. 2:42-42 (2005)
Relevance
Glycoprotein N
Plays a role in virion attachment to host receptor.
This attachment induces virion internalization predominantly through clathrin-dependent endocytosis Glycoprotein N probably locks the Gn-Gc complex in a prefusion state
Glycoprotein C
Binds to host cell surface receptor LDLR and mediates fusion between viral and cellular membranes.
Attachment to receptor induces virion internalization predominantly through clathrin-dependent endocytosis.
Class II fusion protein that promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion.
Exposure of the glycoprotein spikes to potassium is necessary for the conformational change leading to fusion.
Research area
Signal Transduction
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Mammalian cell
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 10xHis-tagged
Target protein sequenc
KPTVSTANIALSWSSVEHRGNKILVSGRSESIMKLEERTGISWDLGVEDASESKLLTVSVMDLSQMYSPVFEYLSGDRQVGEWPKATCTGDCPERCGCTSSTCLHKEWPHSRNWRCNPTWCWGVGTGCTCCGLDVKDLFTDYMFVKWKVEYIKTEAIVCVELTSQERQCSLIEAGTRFNLGPVTITLSEPRNIQQKLPPEIITLHPRIEEGFFDLMHVQKVLSASTVCKLQSCTHGVPGDLQVYHIGNLLKGDKVNGHLIHKIEPHFNTSWMSWDGCDLDYYCNMGDWPSCTYTGVTQHNHASFVNLLNIETDYTKNFHFHSKRVTAHGDTPQLDLKARPTYGAGEITVLVEVADMELHTKK
Uniprot id
Q8JSZ3
Documents
Documents
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial (Active)
Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial (Active)
Regular price
$1,900.00
Sale price
$1,900.00
Regular price
Unit price
/per
Shipping calculated at checkout.
Documents
Available in stock (500)
×
Request a Quote
- Worldwide delivery & full concierge support
- AI Agent for guided support and curated product search
- Track Your Order Status Anytime
Couldn't load pickup availability
Limited time offer
Get $200 off when you spend $2,500 or more!
Product Overview
Product Overview
Abbreviation
Recombinant Crimean-Congo hemorrhagic fever virus GP protein, partial (Active)
Alternative names
Envelopment polyprotein; M polyprotein; Mucin-like variable region; GP38; Glycoprotein NNon-Structural protein M; Glycoprotein C; GP
Buffer [rich text]
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Expression region
1078-1439aa
Form
Lyophilized powder
Gene names
GP
Mw
42.2 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) (CCHFV)
Protein length
Partial
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Intracellular localization of Crimean-Congo Hemorrhagic Fever (CCHF) virus glycoproteins.
Haferkamp S., Fernando L., Schwarz T.F., Feldmann H., Flick R.
Virol. J. 2:42-42 (2005)
Relevance
Glycoprotein N
Plays a role in virion attachment to host receptor.
This attachment induces virion internalization predominantly through clathrin-dependent endocytosis Glycoprotein N probably locks the Gn-Gc complex in a prefusion state
Glycoprotein C
Binds to host cell surface receptor LDLR and mediates fusion between viral and cellular membranes.
Attachment to receptor induces virion internalization predominantly through clathrin-dependent endocytosis.
Class II fusion protein that promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion.
Exposure of the glycoprotein spikes to potassium is necessary for the conformational change leading to fusion.
Research area
Signal Transduction
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Mammalian cell
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 10xHis-tagged
Target protein sequenc
KPTVSTANIALSWSSVEHRGNKILVSGRSESIMKLEERTGISWDLGVEDASESKLLTVSVMDLSQMYSPVFEYLSGDRQVGEWPKATCTGDCPERCGCTSSTCLHKEWPHSRNWRCNPTWCWGVGTGCTCCGLDVKDLFTDYMFVKWKVEYIKTEAIVCVELTSQERQCSLIEAGTRFNLGPVTITLSEPRNIQQKLPPEIITLHPRIEEGFFDLMHVQKVLSASTVCKLQSCTHGVPGDLQVYHIGNLLKGDKVNGHLIHKIEPHFNTSWMSWDGCDLDYYCNMGDWPSCTYTGVTQHNHASFVNLLNIETDYTKNFHFHSKRVTAHGDTPQLDLKARPTYGAGEITVLVEVADMELHTKK
Uniprot id
Q8JSZ3
Documents
Documents
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial (Active)
Regular price
$1,900.00
Sale price
$1,900.00
Regular price
Unit price
/per
