New

Large collection of high-quality Antibodies!
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP856431HU4

$2,062.00
$2,062.00
Shipping calculated at checkout.

Documents

Manual

Available in stock (500)

size: 1mg
View UniProt Entry
×

Request a Quote

Limited time offer

Get $200 off when you spend $2,500 or more!

Product Overview

Abbreviation
Recombinant Human TAF15 protein, partial
Alternative names
68 kDa TATA-binding protein-associated factor;RNA-binding protein 56
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
1-119aa
Form
Liquid or Lyophilized powder
Gene names
TAF15
Mw
19.8 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Partial of Isoform Long
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Relevance
RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3'. Can enter the preinitiation complex together with the RNA polymerase II (Pol II)
Research area
Epigenetics and Nuclear Signaling
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 6xHis-tagged
Target protein sequenc
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQ
Uniprot id
Q92804
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

$2,062.00
$2,062.00