Bone Specific Alkaline Phosphatase (Rat), Polyclonal

Bone Alkaline Phosphatase, also known as bone-specific alkaline phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takara Bio's Bone Specific Alkaline Phosphatase (Rat), Polyclonal antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase. This product was raised against conjugate of KLH and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] that illustrates an exceptional homology with human and rat Bone Specific Alkaline Phosphatase. Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval. Specificity: rat bone-specific alkaline phosphatase Human antigens (slight reactivity)