Recombinant Arabidopsis thaliana Target of rapamycin complex subunit LST8-1 (LST8-1)
Regular price
$1,812.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Mouse-ear cress LST8-1 protein
Alternative names
TORC subunit LST8 homolog 1;Lethal with SEC13 protein 8 homolog 1
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
1-305aa
Form
Liquid or Lyophilized powder
Gene names
LST8-1
Mw
41.2 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Arabidopsis thaliana (Mouse-ear cress)
Protein length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Relevance
Component of TORC1 complex, which is an essential cell growth regulator that controls plant development. Acts by activating transcription, protein synthesis and ribosome biogenesis, and inhibiting mRNA degradation and autophagy (Probable). Involved in regulating amino acid accumulation and the synthesis of myo-inositol and raffinose during plant adaptation to long days. Involved in the regulation of plant growth and abscisic acid (ABA) accumulation. Acts as positive regulation of the ABA biosynthetic genes ZEP, NCED3 and AAO3, and negative regulator of the ABA catabolic genes CYP707A2 and CYP707A3.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 6xHis-tagged
Target protein sequenc
MSQPSVILATASYDHTIRFWEAETGRCYRTIQYPDSHVNRLEITPDKHYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNNVMAVGFQCDAKWMYSGSEDGTVKIWDLRAPGCQKEYESVAAVNTVVLHPNQTELISGDQNGNIRVWDLRANSCSCELVPEVDTAVRSLTVMWDGTMVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTVKIWNVDGFKLEKVLTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHKATVCCALHD
Uniprot id
Q9LV27
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Arabidopsis thaliana Target of rapamycin complex subunit LST8-1 (LST8-1)
Regular price
$1,812.00 USD
Sale price
Regular price
Unit price
/per

