Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ac (cry1Ac), partial
Regular price
$2,959.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Bacillus thuringiensis subsp. kurstaki cry1Ac protein, partial
Alternative names
133KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(c)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
972-1178aa
Form
Liquid or Lyophilized powder
Function
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Gene names
cry1Ac
Mw
25.8 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Bacillus thuringiensis subsp. kurstaki
Protein length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300(1985)
Relevance
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Yeast
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Uniprot id
P05068
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ac (cry1Ac), partial
Regular price
$2,959.00 USD
Sale price
Regular price
Unit price
/per

