Recombinant Bovine Phosphotriesterase-related protein (PTER)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP018966BO

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Bovine PTER protein
Alternative names
(Parathion hydrolase-related protein)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
1-349aa
Form
Liquid or Lyophilized powder
Gene names
PTER
Mw
46.5 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Bos taurus (Bovine)
Protein length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Relevance
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
MSSLSGKVQTVLGLVEPGTLGRTLTHEHLTMTFDCCYYPPPPSHEAISKEPIIMKNLFWIQKNPYSHKENLQLNQETEAIKEELLDFKAKGGGALVENTTTGLSRDVRTLKWLAEETGVHIIAGAGFYVDATHSSETRAKSVEQLTDVLVNEILCGADGTSIKCGVIGEIGCSWPLTDSERKVLQATAHAQTQLGCPVIIHPGRNQSAPFQIIRVLQEAGGDISKTVMSHIDRTILDKKELLEFAQFGCYLEYDLFGTELFHYQFNPDIDMPNDNKRIKRVRLLVDEGYEDRILMAHDIHTKNRLTKYGGHGYSHILTNIVPKMLLRGITEGALDKILIENPKQWLTFK
Uniprot id
A6QLJ8
Recombinant Bovine Phosphotriesterase-related protein (PTER)

Recombinant Bovine Phosphotriesterase-related protein (PTER)

$2,466.00 USD