Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23
Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP3170DJHa0

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23 protein
Alternative names
Major house dust mite allergen Der p 23 （Major HDM allergen Der p 23） (Peritrophin-like protein Der p 23)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
22-90aa
Form
Liquid or Lyophilized powder
Mw
10.3 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Dermatophagoides pteronyssinus (European house dust mite)
Protein length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Identification of Der p 23, a Peritrophin-like Protein, as a New Major Dermatophagoides pteronyssinus Allergen Associated with the Peritrophic Matrix of Mite Fecal Pellets." Weghofer M., Grote M., Resch Y., Casset A., Kneidinger M., Kopec J., Thomas W.R., Fernandez-Caldas E., Kabesch M., Ferrara R., Mari A., Purohit A., Pauli G., Horak F., Keller W., Valent P., Valenta R., Vrtala S. J. Immunol. 190:3059-3067(2013)
Relevance
Does not bind chitin in vitro.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT
Uniprot id
L7N6F8
Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

$2,466.00 USD