Recombinant Dog Interleukin-33 (IL33), partial
Recombinant Dog Interleukin-33 (IL33), partial
Recombinant Dog Interleukin-33 (IL33), partial
Recombinant Dog Interleukin-33 (IL33), partial

Recombinant Dog Interleukin-33 (IL33), partial

Vendor: CUSABIO

Type: Proteins

SKU: CSB-YP011656DO

$2,959.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Dog IL33 protein, partial
Alternative names
(IL-33)(Protein DVS27)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
102-263aa
Form
Liquid or Lyophilized powder
Gene names
IL33
Mw
19.5 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Canis lupus familiaris (Dog) (Canis familiaris)
Protein length
Partial
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Identification of genes differentially expressed in canine vasospastic cerebral arteries after subarachnoid hemorrhage." Onda H., Kasuya H., Takakura K., Hori T., Imaizumi T., Takeuchi T., Inoue I., Takeda J. J. Cereb. Blood Flow Metab. 19:1279-1288(1999)
Relevance
Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
Research area
Cardiovascular
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Yeast
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS
Uniprot id
O97863
Recombinant Dog Interleukin-33 (IL33), partial

Recombinant Dog Interleukin-33 (IL33), partial

$2,959.00 USD