Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP357663ECCc7

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Enterobacteria phage 933W stxB2 protein
Alternative names
SLT-2 B subunit;SLT-2b;SLT-IIb;Verocytotoxin 2 subunit B;Verotoxin 2 subunit B
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
20-89aa
Form
Liquid or Lyophilized powder
Gene names
stxB2
Mw
14.7 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Enterobacteria phage 933W (Bacteriophage 933W)
Protein length
Full Length of Mature Protein
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Relevance
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 6xHis-tagged
Target protein sequenc
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Uniprot id
P09386
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

$2,466.00 USD