Recombinant Escherichia coli 30S ribosomal protein S15 (rpsO)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-RP087174Ba

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant E.coli rpsO protein
Alternative names
rpsO; secC; b3165; JW3134; 30S ribosomal protein S15; Small ribosomal subunit protein uS15
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
2-89aa
Form
Liquid or Lyophilized powder
Function
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA
Gene names
rpsO
Mw
14.1 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Escherichia coli (strain K12)
Protein length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997)
Relevance
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assbly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA.In the E.coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
Uniprot id
P0ADZ4
Recombinant Escherichia coli 30S ribosomal protein S15 (rpsO)

Recombinant Escherichia coli 30S ribosomal protein S15 (rpsO)

$2,466.00 USD