Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial
Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial

Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP318172HIR

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Human adenovirus F serotype 40 Hexon protein, partial
Alternative names
(CP-H)(Protein II)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
601-830aa
Form
Liquid or Lyophilized powder
Gene names
L3
Mw
33.8 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40)
Protein length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"The genes encoding the DNA binding protein and the 23K protease of adenovirus types 40 and 41." Vos H.L., der Lee F.M., Reemst A.M.C.B., van Loon A.E., Sussenbach J.S. Virology 163:1-10(1988).
Relevance
Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
LEAMLRNDTNDQSFNDYLCAANMLYPIPANATSVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFTYSGSVPYLDGTFYLNHTFKKVSVMFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLIQMLSHYNIGYQGFHVPESYKDRMYSFFRNFQPMSRQVVDTTTYTEYQNVTLPFQHNNSGFVGYMGPAIREGQAYPANYPYPLIGQTAVPSL
Uniprot id
P11819
Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial

Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial

$2,466.00 USD