Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)
Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)

Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP860244HU

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Human MACROD1 protein
Alternative names
MACRO domain-containing protein 1 O-acetyl-ADP-ribose deacetylase MACROD1 Protein LRP16 [Protein ADP-ribosylaspartate] hydrolase MACROD1 [Protein ADP-ribosylglutamate] hydrolase MACROD1
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
1-325aa
Form
Liquid or Lyophilized powder
Gene names
MACROD1
Mw
41.5 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Macrodomain-containing proteins are new mono-ADP-ribosylhydrolases." Rosenthal F., Feijs K.L., Frugier E., Bonalli M., Forst A.H., Imhof R., Winkler H.C., Fischer D., Caflisch A., Hassa P.O., Luescher B., Hottiger M.O. Nat. Struct. Mol. Biol. 20:502-507(2013)
Relevance
Removes ADP-ribose from asparatate and glutamate residues in proteins bearing a single ADP-ribose moiety (PubMed:23474714, PubMed:23474712). Inactive towards proteins bearing poly-ADP-ribose (PubMed:23474714, PubMed:23474712). Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins (PubMed:21257746). Plays a role in estrogen signaling (PubMed:17893710, PubMed:17914104, PubMed:19403568). Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen (PubMed:19022849). May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PubMed:17893710, PubMed:17914104). Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction (PubMed:17914104). Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PubMed:17893710). Enhances ESR1-mediated transcription activity (PubMed:17914104).
Research area
Cancer
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA
Uniprot id
Q9BQ69
Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)

Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)

$2,466.00 USD