Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-MP860774HU

$6,678.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Human GPR20 protein-VLPs (Active)
Buffer [rich text]
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Expression region
1-358aa
Form
Lyophilized powder
Gene names
GPR20
Mw
40.0 kDa
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Organism
Homo sapiens (Human)
Protein length
Full Length
Purity
The purity information is not available for VLPs proteins.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Reference [rich text]
Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus. Feldman D.S., Zamah A.M., Pierce K.L., Miller W.E., Kelly F., Rapacciuolo A., Rockman H.A., Koch W.J., Luttrell L.M. J Biol Chem 277:28631-28640 (2002)
Relevance
Orphan receptor with constitutive G(i) signaling activity that activate cyclic AMP.
Research area
Signal Transduction
Sds description [rich text]
CSB-MP860774HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)
Source
Mammalian cell
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Target protein sequenc
MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Uniprot id
Q99678
Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

$6,678.00 USD