Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), partial
Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), partial

Vendor: CUSABIO

Type: Proteins

SKU: CSB-YP008533HU1

$2,310.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Human FCER1G protein, partial
Alternative names
Fc receptor gamma-chain ;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma ;FceRI gamma
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
45-86aa
Form
Liquid or Lyophilized powder
Function
Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Gene names
FCER1G
Mw
6.9 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Cytoplasmic Domain
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Characterization and expression of the gene for the human Fc receptor gamma subunit. Definition of a new gene family.Kuester H., Thompson H., Kinet J.-P.J. Biol. Chem. 265:6448-6452(1990)
Relevance
Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Research area
Immunology
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Yeast
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Uniprot id
P30273
Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), partial

$2,310.00 USD