Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

Vendor: CUSABIO

Type: Proteins

SKU: CSB-YP011661HU1

$2,959.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Human IL4R protein, partial
Alternative names
IL-4 receptor subunit alpha;IL-4R subunit alpha;IL-4R-alpha;IL-4RA;CD antigen CD124;Soluble IL-4 receptor subunit alpha;Soluble IL-4R-alpha;sIL4Ralpha/prot;IL-4-binding protein;IL4-BP
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
26-232aa
Form
Liquid or Lyophilized powder
Gene names
IL4R
Mw
25.2 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Partial
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Relevance
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. ; Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
Research area
Immunology
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Yeast
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Uniprot id
P24394
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

$2,959.00 USD