Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)
Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)

Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP843276HUd8

$1,812.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Human AADAT protein
Alternative names
2-aminoadipate aminotransferase;2-aminoadipate transaminase;Alpha-aminoadipate aminotransferase;Glycine transaminase AADAT;Kynurenine aminotransferase II;Kynurenine--glyoxylate transaminase AADAT;Kynurenine--oxoglutarate aminotransferase II;Kynurenine--oxoglutarate transaminase 2;Kynurenine--oxoglutarate transaminase II;Methionine--glyoxylate transaminase AADAT
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
30-425aa
Form
Liquid or Lyophilized powder
Gene names
AADAT
Mw
88.0 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Relevance
Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro)
Research area
Signal Transduction
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal MBP-tagged and C-terminal 6xHis-tagged
Target protein sequenc
PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Uniprot id
Q8N5Z0
Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)

Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)

$1,812.00 USD