Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-MP008543HU1

$1,940.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Human FCGR3A protein, partial (Active)
Alternative names
IgG Fc receptor III-A;CD16-II;CD16a antigen;Fc-gamma RIII-alpha;Fc-gamma RIII;Fc-gamma RIIIa;FcRIII;FcRIIIa;FcgammaRIIIA;FcR-10;IgG Fc receptor III-2;CD antigen CD16a
Buffer [rich text]
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Expression region
17-208aa
Form
Lyophilized powder
Gene names
FCGR3A
Mw
22.7 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Partial
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Alternative membrane forms of Fc gamma RIII(CD16) on human natural killer cells and neutrophils. Cell type-specific expression of two genes that differ in single nucleotide substitutions. Ravetch J.V., Perussia B. J. Exp. Med. 170:481-497 (1989)
Relevance
Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger.
Research area
Immunology
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Mammalian cell
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 6xHis-tagged
Target protein sequenc
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Uniprot id
P08637
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

$1,940.00 USD