Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA)
Regular price
$1,812.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Human LIPA protein
Alternative names
Cholesteryl esterase
Lipase A
Sterol esterase
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
22-399aa
Form
Liquid or Lyophilized powder
Gene names
LIPA
Mw
47.1 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Tissue and cellular specific expression of murine lysosomal acid lipase mRNA and protein."
Du H., Witte D.P., Grabowski G.A.
J. Lipid Res. 37:937-949(1996)
Relevance
Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.
Research area
Cardiovascular
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-tagged
Target protein sequenc
SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Uniprot id
P38571
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA)
Regular price
$1,812.00 USD
Sale price
Regular price
Unit price
/per
