Recombinant Human N-formyl peptide receptor 2 (FPR2)-VLPs
Regular price
$6,678.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Human FPR2 protein-VLPs
Alternative names
FMLP-related receptor I (FMLP-R-I);Formyl peptide receptor-like 1;HM63;Lipoxin A4 receptor (LXA4 receptor);RFP
Buffer [rich text]
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Endotoxin
Not test
Expression region
1-351aa
Form
Lyophilized powder
Gene names
FPR2
Mw
40.3 kDa
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Organism
Homo sapiens (Human)
Protein length
Full Length of Mature Protein
Purity
The purity information is not available for VLPs proteins.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃.
Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Relevance
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (PubMed:1374236).
Binding of FMLP to the receptor causes activation of neutrophils.
Research area
Cardiovascular
Sds description [rich text]
CSB-MP008855HU is detected by Mouse anti-6*His monoclonal antibody.
Source
Mammalian cell
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Target protein sequenc
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Uniprot id
P25090
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Human N-formyl peptide receptor 2 (FPR2)-VLPs
Regular price
$6,678.00 USD
Sale price
Regular price
Unit price
/per

