Recombinant Human Protein IWS1 homolog (IWS1), partial
Regular price
$2,466.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Human IWS1 protein, partial
Alternative names
IWS1-like protein
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
530-694aa
Form
Liquid or Lyophilized powder
Gene names
IWS1
Mw
25.7 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Homo sapiens (Human)
Protein length
Partial
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Relevance
Transcription factor which plays a key role in defining the composition of the RNA polymerase II (RNAPII) elongation complex and in modulating the production of mature mRNA transcripts. Acts as an assembly factor to recruit various factors to the RNAPII elongation complex and is recruited to the complex via binding to the transcription elongation factor SUPT6H bound to the C-terminal domain (CTD) of the RNAPII subunit RPB1 (POLR2A). The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10) as well as histone modifying enzymes (such as SETD2) to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription.
Research area
Epigenetics and Nuclear Signaling
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 6xHis-tagged
Target protein sequenc
EMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTS
Uniprot id
Q96ST2
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Human Protein IWS1 homolog (IWS1), partial
Regular price
$2,466.00 USD
Sale price
Regular price
Unit price
/per

