Recombinant Lecanicillium psalliotae Alkaline serine protease ver112
Regular price
$2,466.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Lecanicillium psalliotae Alkaline serine protease ver112 protein
Alternative names
Alkaline serine protease ver112; EC 3.4.21.-
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
103-382aa
Form
Liquid or Lyophilized powder
Function
Serine protease which can degrade the nematode cuticle.
Mw
36.0 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Lecanicillium psalliotae (Verticillium psalliotae)
Protein length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"The crystal structures of two cuticle-degrading proteases from nematophagous fungi and their contribution to infection against nematodes."
Liang L., Meng Z., Ye F., Yang J., Liu S., Sun Y., Guo Y., Mi Q., Huang X., Zou C., Rao Z., Lou Z., Zhang K.Q.
FASEB J. 24:1391-1400(2010)
Relevance
Serine protease which can degrade the nematode cuticle.
Research area
Others
Sds description [rich text]
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP737896LCAT could indicate that this peptide derived from E.coli-expressed Lecanicillium psalliotae (Verticillium psalliotae) N/A.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQTLSTKNVLTSIPSGTVNYLAFNGAT
Uniprot id
Q68GV9
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Lecanicillium psalliotae Alkaline serine protease ver112
Regular price
$2,466.00 USD
Sale price
Regular price
Unit price
/per

