Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1
Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP324858LDT

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Leiurus Beta-insect excitatory toxin LqqIT1 protein
Alternative names
Insect toxin 1 (LqqIT1')
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
1-70aa
Form
Liquid or Lyophilized powder
Mw
12.9 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)
Protein length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Primary structure of scorpion anti-insect toxins isolated from the venom of Leiurus quinquestriatus quinquestriatus." Kopeyan C., Mansuelle P., Sampieri F., Brando T., Bahraoui E.M., Rochat H., Granier C. FEBS Lett. 261:423-426(1990)
Relevance
Excitatory insect beta-toxins induce a spastic paralysis. They bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin induces a fast excitatory contraction paralysis on fly larvae. It is active only on insects.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN
Uniprot id
P19856
Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

$2,466.00 USD