Recombinant Macaca fascicularis Low affinity immunoglobulin gamma Fc region receptor III (FCGR3A), partial, Biotinylated (Active)
Regular price
$2,100.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Cynomolgus monkey FCGR3A protein, partial, Biotinylated (Active)
Alternative names
Low affinity immunoglobulin gamma Fc region receptor III-A; IgG Fc receptor III-A; Fc-gamma RIII-alpha (Fc-gamma RIII; Fc-gamma RIIIa; FcgammaRIIIa; CD16a; FCGR3A; FCGR3
Buffer [rich text]
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Expression region
17-208aa
Form
Lyophilized powder
Gene names
FCGR3A
Mw
26.9 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Protein length
Partial
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
IgG Fc receptor III homologues in nonhuman primate species: genetic characterization and ligand interactions.
Rogers K.A., Scinicariello F., Attanasio R.
J. Immunol. 177:3848-3856 (2006)
Relevance
Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger.
Mediates IgG effector functions on natural killer (NK) cells. Binds antigen-IgG complexes generated upon infection and triggers NK cell-dependent cytokine production and degranulation to limit viral load and propagation. Involved in the generation of memory-like adaptive NK cells capable to produce high amounts of IFNG and to efficiently eliminate virus-infected cells via ADCC. Regulates NK cell survival and proliferation, in particular by preventing NK cell progenitor apoptosis .
Fc-binding subunit that associates with CD247 and/or FCER1G adapters to form functional signaling complexes. Following the engagement of antigen-IgG complexes, triggers phosphorylation of immunoreceptor tyrosine-based activation motif (ITAM)-containing adapters with subsequent activation of phosphatidylinositol 3-kinase signaling and sustained elevation of intracellular calcium that ultimately drive NK cell activation. The ITAM-dependent signaling coupled to receptor phosphorylation by PKC mediates robust intracellular calcium flux that leads to production of pro-inflammatory cytokines, whereas in the absence of receptor phosphorylation it mainly activates phosphatidylinositol 3-kinase signaling leading to cell degranulation.
Costimulates NK cells and trigger lysis of target cells independently of IgG binding (By similarity).
Mediates the antitumor activities of therapeutic antibodies. Upon ligation on monocytes triggers TNFA-dependent ADCC of IgG-coated tumor cells.
Mediates enhanced ADCC in response to afucosylated IgGs.
Research area
Immunology
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Mammalian cell
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal 10xHis-Avi-tagged
Target protein sequenc
GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ
Uniprot id
Q8SPW2
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Macaca fascicularis Low affinity immunoglobulin gamma Fc region receptor III (FCGR3A), partial, Biotinylated (Active)
Regular price
$2,100.00 USD
Sale price
Regular price
Unit price
/per

