Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)
Regular price
$2,264.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Cynomolgus monkey NCR3 protein, partial (Active)
Alternative names
Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein (NK-p30;NKp30); CD337; NCR3
Buffer [rich text]
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Expression region
19-135aa
Form
Lyophilized powder
Gene names
NCR3
Mw
42.0 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Protein length
Partial
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
Identification, molecular cloning and functional characterization of NKp46 and NKp30 natural cytotoxicity receptors in Macaca fascicularis NK cells.
De Maria A., Biassoni R., Fogli M., Rizzi M., Cantoni C., Costa P., Conte R., Mavilio D., Ensoli B., Moretta L.
Eur. J. Immunol. 31:3546-3556 (2001)
Relevance
Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG that promote DC maturation.
Research area
Immunology
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
Mammalian cell
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
C-terminal hFc1-avi-tagged
Target protein sequenc
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLG
Uniprot id
P61483
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)
Regular price
$2,264.00 USD
Sale price
Regular price
Unit price
/per

