Recombinant Mycobacterium tuberculosis Lipoarabinomannan carrier protein LprG (lprG)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP358685MVZ

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Mycobacterium tuberculosis lprG protein
Alternative names
27 kDa lipoprotein;Antigen P27;Lipoprotein LprG;Triacylglyceride transfer protein LprG
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
27-236aa
Form
Liquid or Lyophilized powder
Gene names
lprG
Mw
29.2 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Protein length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains." Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M. J. Bacteriol. 184:5479-5490(2002)
Relevance
Probably helps membrane protein MT1454 (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm and probably ultimately to the outer membrane. TAG probably regulates lipid metabolism and growth regulation. Binds di- and triacylated phosphatidyl-myo-inositol mannosides (PIMs), and glycolipid lipoglycan modulins lipoarabinomannan (LAM) and lipomannan (LM), facilitating their recognition by TLR2. Required for activity of drug efflux transporter MT1454. Required, probably with MT1454, for normal surface localization of LAM. Constitutes a host TLR2 agonist (toll-like receptor).
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
CSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS
Uniprot id
P9WK44
Recombinant Mycobacterium tuberculosis Lipoarabinomannan carrier protein LprG (lprG)

Recombinant Mycobacterium tuberculosis Lipoarabinomannan carrier protein LprG (lprG)

$2,466.00 USD