Recombinant Rat Heparanase (Hpse), partial
Regular price
$2,466.00 USD
Sale price
Regular price
Unit price
/per
Shipping calculated at checkout.
Available in stock (500)
Request a Quote
✅ Thank you! Your quote request was sent successfully.
❌ Something went wrong. Please check your details and try again.
- Customs clearance fees may apply
- Worldwide shipping available.
Couldn't load pickup availability
For research use only — not intended for clinical or diagnostic purposes.
Product Overview
Product Overview
Abbreviation
Recombinant Rat Hpse protein, partial
Alternative names
Endo-glucoronidase (Hep)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
29-102aa
Form
Liquid or Lyophilized powder
Gene names
Hpse
Mw
15.8 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Rattus norvegicus (Rat)
Protein length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"Heparanase accelerates wound angiogenesis and wound healing in mouse and rat models."
Zcharia E., Zilka R., Yaar A., Yacoby-Zeevi O., Zetser A., Metzger S., Sarid R., Naggi A., Casu B., Ilan N., Vlodavsky I., Abramovitch R.
FASEB J. 19:211-221(2005)
Relevance
Endoglycosidase that cleaves heparan sulfate proteoglycans into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extracellular matrix, independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.
Research area
Cancer
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE
Uniprot id
Q71RP1
Background
Background
Product Citations
Product Citations
More Info
More Info
Recombinant Rat Heparanase (Hpse), partial
Regular price
$2,466.00 USD
Sale price
Regular price
Unit price
/per

