Recombinant Rift valley fever virus Non-structural protein NS-S (NSS)

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP325136REV

$2,466.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Rift valley fever virus NSS protein
Alternative names
(NSs)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
1-265aa
Form
Liquid or Lyophilized powder
Gene names
NSS
Mw
37.3 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Rift valley fever virus (strain ZH-548 M12) (RVFV)
Protein length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Reference [rich text]
"NSs amyloid formation is associated with the virulence of Rift Valley fever virus in mice." Leger P., Nachman E., Richter K., Tamietti C., Koch J., Burk R., Kummer S., Xin Q., Stanifer M., Bouloy M., Boulant S., Kraeusslich H.G., Montagutelli X., Flamand M., Nussbaum-Krammer C., Lozach P.Y. Nat. Commun. 11:3281-3281(2020)
Relevance
Plays a role in the escape of host innate immune response by promoting the degradation of host EIF2AK2/PKR and inhibiting host transcription . Cytoplasmic NSs interacts with host FBXW11 to degrade PKR whereas nuclear pool binds to host FBXO3 to target TFIIH subunit GTF2H1 for proteasomal degradation with the help of the linker protein SKP1 . Removes FBXO3 isoform 1 from the nucleus . Forms nuclear amyloid-like filaments of about 12 nm in width that may sequester NSs binding partners, causing cell cycle arrest . Also aggragates in the cytosol as short fibrils late after host cell infection . Plays a role in cell morphology and/or motility, reduction of lamellipodia, cell spreading, and dissolution of adherens junctions .
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein sequenc
MDYFPVISVDLQSGRRVVSVEYFRGDGPPRIPYSMVGPCCVFLMHHRPSHEVRLRFSDFYNVGEFPYRVGLGDFASNVAPPPAKPFQRLIDLIGHMTLSDFTRFPNLKEAISWPLGEPSLAFFDLSSTRVHRNDDIRRDQIATLAMRSCKITNDLEDSFAGLHRMIATEAILRGIDLCLLPGFDLMYEVAHVQCVRLLQAAKEDISNAVVPNSALIVLMEESLMLRSSLPSMMGRNNWIPVIPPIPDVEMESEEESDDDGFVEVD
Uniprot id
P21698
Recombinant Rift valley fever virus Non-structural protein NS-S (NSS)

Recombinant Rift valley fever virus Non-structural protein NS-S (NSS)

$2,466.00 USD