Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme, Biotinylated
Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme, Biotinylated

Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme, Biotinylated

Vendor: CUSABIO

Type: Proteins

SKU: CSB-EP357414SXPm4-B

$2,632.00 USD
Shipping calculated at checkout.

Available in stock (500)

View UniProt Entry
  • Customs clearance fees may apply
  • Worldwide shipping available.
For research use only — not intended for clinical or diagnostic purposes.

Product Overview

Abbreviation
Recombinant Schistosoma japonicum GST 26, Biotinylated
Alternative names
(GST 26)(Sj26 antigen)(SjGST)
Buffer [rich text]
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin
Not test
Expression region
2-218aa
Form
Liquid or Lyophilized powder
Mw
39.3 kDa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Organism
Schistosoma japonicum (Blood fluke)
Protein length
Full Length of Mature Protein
Purity
Greater than 95% as determined by SDS-PAGE.
Reconstitution [rich text]
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Relevance
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.; GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.
Research area
Others
Sds description [rich text]
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Source
E.coli
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Tag info
N-terminal 6xHis-SUMO3-Avi-tagged
Target protein sequenc
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Uniprot id
P08515
Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme, Biotinylated

Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme, Biotinylated

$2,632.00 USD